Amicus Brief — Smith v. Daily Mail Publishing Co.
Supreme Court brief1979
Ask Donna
What actually matters in this document.
Text
s “¢
IN THE
: Supreme Court of the United States
OcTOBER TERM, 1978
No. 78-482
THe Hon. ROBERT K. SMITH, JUDGE, ET AL., ETC.,
Petitioners,
Vv.
STATE EX REL. Dam_y MAtrL PUBLISHING CO., ETC. ET AL.,
Respondents.
THE HON. RoBERT K. SMITH, JUDGE, ET AL., ETC.,
Petitioners,
Vv.
DON MARSH, ET AL., THE DAILY GAZETTE CO., ETC. ET AL.,
Respondents.
On Writ of Certiorari to the West Virginia
Supreme Court of Appeals
MOTION OF AMERICAN NEWSPAPER PUBLISHERS
ASSOCIATION
FOR LEAVE TO FILE BRIEF AMICUS
CURIAE AND BRIEF AMICUS CURIAE
ARTHUR B. HANSON
FraNK M. NorRTHAM
MITCHELL W. DALE
ArTHUR D. MCKEY
HANSON, O’BRIEN, BIRNEY
AND BUTLER
888 Seventeenth Street, N.W.
Suite 1000
Washington, D.C. 20006
Attorneys for Amicus Curiae
American Newspaper Publishers
Association
IN THE
Supreme Cowt of the Wnited States
OcToBER TERM, 1978
No. 78-482
THE HON. ROBERT K. SMITH, JUDGE, ET AL., ETC.,
Petitioners,
Vv.
STATE EX REL. DaILy MAIL PUBLISHING CO., ETC. ET AL.,
Respondents.
THE Hon. Rosert K. SMITH, JUDGE, ET AL., ETC.,
Petitioners,
Vv.
DON MARSH, ET AL., THE DaILy GAZETTE CO., ETC. ET AL.,
Respondents.
On Writ of Certiorari to the
West Virginia Supreme Court of Appeals
MOTION OF AMERICAN NEWSPAPER PUBLISHERS
ASSOCIATION
FOR LEAVE TO FILE BRIEF AMICUS CURIAE
The American Newspaper Publishers Association
(ANPA) respectfully moves this Court for leave to file the
accompanying Brief Amicus Curiae in support of Respondents,
2
urging affirmance of the decision of the Supreme Court of
Appeals of West Virginia. Although the attorneys for Respon-
dents have consented to ANPA’s filing a brief amicus curiae,
the Petitioners have withheld consent.
The American Newspaper Publishers Association
(ANPA) is a non-profit membership corporation organized
and existing under the laws of the Commonwealth of Virginia.
Its membership consists of more than 1324 newspapers repre-
senting more than 91 percent of the total daily and Sunday
newspaper circulation in the United States. ANPA is concerned
with issues of general significance to the profession of journa-
lism and the newspaper business and, over the years, ANPA on
several occasions has presented its views to the Supreme Court
of the United States and to other federal and state appellate
courts. ANPA numbers eighteen members in the State of West
Virginia.
In its efforts to stay abreast of the broad realm of matters
affecting the people of our country as served by our newspaper
members, and the journalists who work for them, ANPA is ever
vigilant to protect the public’s right, under the First Amend-
ment, to information concerning the activities of government
and matters of public interest. ANPA and its members are
vitally interested in protecting and maintaining the primary
function of newspapers under our value system; namely, the
dissemination of information which is of vital interest to the
public.
In the case before this Court, the state of West Virginia has
imposed a system of prior restraint aimed specifically at
newspapers and only at newspapers. The statute in question
requires newspapers to apply to a court for prior permission to
publish constitutionally protected information in which the
public has a iegitimate interest. The statute in question is
without any standards to guide the censoring authority and
requires no assessment of its effectiveness prior to imposition of
3
a restraint on publication. Moreover, the statute uncon-
stitutionally discriminates against newspapers in allowing
broadcasters and other print media to publish the name of a
juvenile involved in delinquency proceedings, while denying
that same right to newspapers.
In view of the importance of the issues raised in this case
ANPA desires to present to this Court, for its assistance, the
Association’s views in regard to the significant legal questions
involved in this proceeding.
WHEREFORE, the American Newspaper Publishers Associ-
ation respectfully requests this Court to grant this motion and
permit ANPA to file the Brief Amicus Curiae attached hereto
and submitted herewith.
Respectfully submitted,
ARTHUR B. HANSON
FRANK M. NORTHAM
MITCHELL W. DALE
ARTHUR D.MCKEY
HANSON, O’BRIEN, BIRNEY
AND BUTLER
888 Seventeenth Street, N.W.
Washington, D.C. 20006
Attorneys for Amicus Curiae,
American Newspaper Publishers
Association
INDEX
COUT TROIS PRIN Be ooo Sansccsckcccncccesccecocosecsencesccese
CONSTITUTIONAL AND STATUTORY PROVI-
SIONS INVOLVED AND STATEMENT OF THE
PS IE E rinep sabia tocisratnersntenip~inidaimemnensanatiipciapittnaiiinns
I. Under the Decisional Authority Governing
Application of the First Amendment to the
United States Constitution, West Virginia
Code 49-7-3 Constitutes an Impermissible
Prior Restraint on Constitutionally Pro-
RRR EE LAT ESTES Re
II. Where a Statutory Scheme Requiring Official
Permission to Exercise First Amendment
Rights is Unconstitutional for Lack of Stan-
dards, Such Statutory Scheme may be lIg-
nored with Impunity.....................:ecceeeeeeeees
III. West Virginia Code 49-7-3 is Constitutionally
Deficient in Failing to Require, Prior to its
Application, a Showing of its Probable
Effectiveness in Achieving The State Inter-
est it is Designed to Serve................ccccseeeeees
IV. West Virginia Code 49-7-3 Violates the Equal
Protection Clause of the Fourteenth
Amendment in Requiring that Only News-
papers Obtain a Court Order Prior to Publi-
13
19
ii
TABLE OF CITA
CASES:
TIONS
Bantam Books, Inc. v. Sullivan, 372 U.S. 58 (1963)...
Bates v. Little Rock, 361 U.S. 516 (1960)
Cantwell v. Connecticut, 310 U.S. 296 (1940)
oer eeeeeee
CBS v. Democratic National Committee, 442 U.S. 94
Ey, CERES ena
Chandler v. Judicial Council, 398 U.S
SOOO RHETT EOE OEE EEEEE
. 74 (1970).......
Chaplinsky v. New Hampshire, 315 U.S. 568 (1942)...
Chicago Police Department v. Mosley, 408 U.S. 92 -
(ISTE taicel, LL... EE
(PPT Sitiettepssemaihoniarseyndeiisines.>-
Craig v. Harney, 331 U.S. 367 (1947)
Elrod v. Burns, 427 U.S. 347 (1976)..
Garrison v. Louisiana, 379 U.S. 64 (1964)
In re Gault, 387 U.S. 1 (1967)............
In re Winship, 397 U.S. 358 (1970)...
Gitlow v. New York, 268 U.S. 652 (1925)
eee ee eee eee eee ee ee ee eee
FOTO OReE eee
Fete eee weeee
eee eee eee eee eee eee
TORO Ree H eee
Government of Virgin Islands v. Brodhurst, 285 F.
Supp. 831 (D.C. Virgin Islands, 1968).....................
Hague v. C.1.0., 307 U.S. 496 (1938)
Houchins v. KQED, Inc., ____U.S.____, 57 L.Ed 2d
3593 ( RB}. ii teil abiteiaedl A.
Inmates of Boys Training School v.
Supp. 1354 (D.R.1. 1972) 0...
Kovacs v. Cooper, 336 U.S. 77 (1949)
Kunz v. New York, 340 U.S. 290 (195
Laird v. Tatum, 409 U.S. 824 (1972)
Affleck, 346 F.
PPP ee eee eee eee ere ees
Pee eee eee eee eee eee ee
i niibplnicntdendenssinis
a
Page
Landmark Communications Inc., v. Virginia,
US. es Re TG | 6, 13, 19
Lovell v. Griffin, 303 U.S. 444 (1938) 0... eeeeeeeeeeeee 15
McKeiver v. Pennsylvania 403 U.S. 528 (1971) .......... 11
McLaughlin v. Florida, 379 U.S. 184 (1964)............... 4,10
Mancuso v. Taft, 476 F.2d 187 (Ist Cir. 1973) ........... 22
Martarella v. Kelly, 349 F. Supp. 575 (S.D.N.Y.
OGTR evcccicicicshdicDa chitinase thse tthalpeatiticesbicinisitalaesest 4,11
Miami Herald Publishing Co. vy. Tornillo, 418 U.S.
BOR CTI cacti dhs cticheccdhnthe Mactunititibaniabindscicsctissiginboes 18, 23
Miller v. California, 413 U.S. 15 (1973) 0... eee eeeeeee 9
Mills v. Alabama, 384 U.S. 214 (1966) ..........0..:eeeee 6
Morales v. Thurman, 383 F. Supp. 53 (E.D. Tex.
PB iceckervncs a cnctocsthadal atbtiatengdgttimepedicteeptesvagyecaetinkers 11
NAACP v. Button, 371 U.S. 415 (1963) ..0..... eee eeeeeee 22
Near v. Minnesota, 283 U.S. 697 (1930) ...............e00008 9
Nebraska Press Ass’n. v. Stuart, 427 U.S. 539 (1976) 4, 5, _ be
Nebraska Press Ass'n v. Stuart, 423 US. 1327
(1975) ( Blackmun, Circuit Justice, mem ).............-- 19
Nelson v. Heyne, 491 F.2d 352 (7th Cir. 1974)............ 11
New York Times Co. v. Sullivan, 376 U.S. 254
i ncncanscat/sctipngs reader cieainansttigaienggenteinpignapscinces 7
New York Times Co. v. United States, 430 U.S. 713
CRG Fi. cccssorniniiasapasingssninicieecpeilieiestpeibontueidtirantiterevesin 10
Pell vy. Procunier, 417 U.S. 817 (1974) co... ccccccceeeeeeeeees 6
Red Lion Broadcasting Co., Inc. v. FCC, 495 US.
GT occcocecsocesosestedinneeentdaiiateididrewsSneittnnandtapconpooes 5, 22, 23
Reed v. Reed, 404 U.S. 71 (1971) .....:cccccecccceesesceereeeees 21
Regents of the University of California v. Bakke
U.S.____, 57 L.Ed.2d 750, (1978 ).................. 21
iv
Puge
Roth v. United States, 354 U.S. 476 (1957)............000+. 9
Schenck v. United States, 249 U.S. 47 (1919)............. 10
Schneider v. State, 308 U.S. 147 (1939) .........cccceeeeeeee 15
Shuttlesworth v. City of Birmingham, 394 U.S. 147
CD ijeewiccssteseensiditih dvlbiitdnpnitligls tint ds ccunieess 5, 15, 17
Skinner v. Oklahoma ex rel. Williamson, 316 U.S.
FE EE cebintintrinscttetsotiritinicdibicigminiiennmetisicigin 22
Southeastern Promotions, Lid. vy. Conrad, 420 U.S.
OE EF Miceositeindnvctetcccenivieoteponnpbtanatiagtintiadinttbthdins 16
State ex rel Harris v. Calendine, 233 S.E. 2d 318
CW AG Or FEF Faia sn piiallintaldlgpeigaeinniinn 12
State ex rel Wilson v. Barnbrick, 195 S.E. 2d 721 -
OE FD whic dies stiiscvtentidsticcsnlaatiaimigpatnicovigiie 12
Staub v. City of Baxley, 355 U.S. 313 (1958) .............. 5
Thomas v. Collins, 323 U.S. 516 (1945) .....ccccccccescceeee 13
United States v. C.1.0., 335 U.S. 106 (1948) «00.0.0... 13
UNITED STATES CONSTITUTION:
TCT Yo OE TE TD passim
Fourteenth Amendment ...................20:ccssccseeceeeeees 12,21,24
CONSTITUTION OF WEST VIRGINIA ............0.c:ccceseeeeeeeees 10
STATUTES:
West Virginia Code § 49-7-3 o00........ccccceceeceecceeeeees passim
OTHER AUTHORITIES:
T. EMERSON, THE SYSTEM OF FREEDOM OF EXPRESSION
Emerson, The Doctrine of Prior Restraint, 20 Law &
CONTEMP. PROB. 648, (1955). ........:ccccseccceceeeeesseeeeeees 4,14
' IN THE
Supreme Court of the United States
OcToBER TERM, 1978
No. 78-482
THE Hon. Rosert K. Smaitu, JupGe, Et AL., Etc.,
Petitioners,
Vv.
STATE Ex Ret. DamLy MAIL PUBLISHING Co., Etc. ET AL.,
Respondents.
THE Hon. ROBERT K. SmiTuH, JuDGE, Et AL., Etc.,
Petitioners,
Vv.
Don Marsh, Et AL., THE DatLy Gazette Co., Etc. Et AL.,
Respondents.
Oa Writ of Certiorari to the West Virginia
Supreme Court of Appeals
BRIEF AMICUS CURIAE OF
AMERICAN NEWSPAPER PUBLISHERS ASSOCIATION
2
PRELIMINARY STATEMENT
The American Newspaper Publishers Association submits
this brief amicus curiae in support of Respondents, Daily Mail
Publishing Co., Don Marsh, The Daily Gazette Co., et al.
INTEREST OF THE AMICUS CURIAE
The American Newspaper Publishers Association (here-
inafter “ANPA”) is a non-profit membership corporation
organized and existing under the laws of the Commonwealth of
Virginia. Its membership consists of more than 1324 news-
papers constituting over 91 percent of the total daily and
Sunday newspaper circulation, and a significant portion of the
weekly newspaper circulation, in the United States. ANPA is
concerned with issues of general significance to the profession
of journalism and the newspaper business, and on several
occasions over the years ANPA has presented its views on such
issues, aS an amicus curiae, to the Supreme Court of the United
States and to other federal and state appellate courts. At
present there are eighteen ANPA members in the State of West
Virginia.
ANPA is greatly concerned about the enactment and
existence of various state statutes which dictate to the press
what matters of public interest may or may not be published;
which subject the exercise of protected press freedoms to prior
censorship at the hands of judges or other governmental
Officials; and which expose American newspapers to criminal
convictions for the truthful publication of newsworthy informa-
tion that has been obtained legally.
Because of these concerns and the potential erosion of First
Amendment freedoms posed by the existence of state statutes
such as West Virginia Code 49-7-3, ANPA respectfully presents
for consideration by this Court its views on the very significant
issues raised in this proceeding.
3
Questions Presented
I. Whether under the decisional authorities of this Court
West Virginia Code Section 49-7-3 constitutes an
unlawful prior restraint on constitutionally protected
speech.
II. Whether West Virginia Code Section 49-7-3 is uncon-
stitutional on its face for lack of ascertainable stan-
dards and may therefore be ignored with impunity.
III. Whether the statute in question is constitutionally
deficient for failing to require the censoring authority
to assess the effectiveness of a prior restraint on
publication.
IV. Whether the statute violates the equal protection clause
of the Fourteenth Amendment in requiring that only
newspapers obtain court permission prior to publica-
tion while the broadcast and other print media are free
to disseminate a juvenile’s name.
Constitutional and Statutory
Provisions Involved and Statement of the Case
ANPA adopts the constitutional and statutory provisions
involved and statement of the case as set forth in the brief of
Respondents. Additionally, ANPA asserts that the statute in
question is violative of the Equal Protection clause of the
Fourteenth Amendment.
SUMMARY OF ARGUMENT
West Virginia Code 49-7-3 imposes an unlawful prior
restraint on publication of information of legitimate public
concern—the identity of a juvenile alleged to have fatally and
feloniously shot a classmate while attending classes at a local
4
public high school. Petitioners assert that maintaining the
confidentiality of a juvenile offender’s identity through a restric-
tion on publication by newspapers serves to effectuate that
juvenile’s “right to rehabilitation” and therefore outweighs any
countervailing First Amendment values. Nonetheless, the
juvenile offender’s so-called right to rehabilitation, which some
courts now regard as correspondent to the Constitution’s prohi-
bition of cruel and unusual punishment and requirement of due
process, see Martarella v. Kelly, 349 F. Supp. 575, 585
(S.D.N.Y. 1972), heretofore has never been held sufficient to
exempt a State from the fundamental doctrine against prior
restraints on publication. See Nebraska Press Association v.
Stuart, 427 U.S. 539 (1976). Moreover, even assuming that
the state policy of rehabilitation rather than punishment, of its
juvenile offenders is “paramount, one of vital importance,”
Elrod v. Burns, 427 U.S. 347, 362 (1976), Petitioners have
presented no evidence to show that West Virginia Code 49-7-3
is “necessary, and not merely rationally related, to the accom-
plishment of [that] policy.” McLaughlin v. Florida, 379 U.S.
184, 196 (1964). If publication of the identity of a juvenile
offender endangers his allegedly paramount right to rehabilita-
tion, “(t]he danger must not be remote or even probable; it
must immediately imperil.” Craig v. Harney, 331 U.S. 367, 376
(1947).
There can be no doubt that the statutory scheme before
this Court, both on its face and in effect, operates as a restraint
on publication since it “undertakes to prevent future publication
without advance approval...{[and is] enforced by criminal
prosecution for having published without the required appro-
val.”” Emerson, The Doctrine of Prior Restraint, 20 LAW AND
CONTEMP. Pros. 648, 655 (1955). But “[iJt is settled by a long
line of ... decisions of this Court that an ordinance which, like
this one, makes the peaceful enjoyment of freedoms which the
Constitution guarantees contingent upon the uncontrolled will
of an official—as by requiring a permit or license which may be
granted or withheld in the discretion of such official—is an
5
unconstitutional censorship or prior restraint upon the enjoy-
ment of those freedoms.” Staub v. Baxley, 355 U.S. 313, 322
(1958).
For, where a statute imposes a prior restraint upon ex-
pression without providing objective and definite standards to
guide the licensing or censoring authority, under the First and
Fourteenth Amendments to the Constitution, parties subject to
such authority “may ignore it and engage with impunity in the
exercise of the right of free expression for which the law
purports to require a license.” Shuttlesworth vy. City of Birming-
ham, 394 U.S. 147, 151 (1969).
In Nebraska Press Ass’n v. Stuart, 427 U.S. 539 (1976),
this Court struck down a gag order prohibiting the particular
content of publication on the ground, inter alia, that the size of
the small community affected and other practical problems
placed the efficacy of the order in grave doubt. West Virginia
Code 49-7-3 is similarly deficient in failing to explicitly require,
prior to its application to a specific publication, an assessment
of its probable effectiveness in preserving a juvenile offender’s
allegedly compelling right to rehabilitation.
Your amicus respectfully submits that the statute in ques-
tion also violates the equal protection clause of the Fourteenth
Amendment in requiring that only newspapers obtain court
permission to publish although the broadcast and other print
media are free to disseminate a juvenile’s name without prior
approval. Differential treatment among various media of
expression is permissible only if “reasonable and applied
without discrimination.” Red Lion Broadcasting Co., Inc. v.
FCC, 395 U.S. 367, 387 (1969); Kovacs v. Cooper, 336 U.S. 77
(1949). The differential treatment directed at newspapers by
West Virginia Code 47-7-3 is manifestly unreasonable and
discriminatory since no legitimate state purpose is served in
prohibiting only one medium from disseminating the name of a
juvenile, particularly where the broadcast media may reach a
much broader audience.
6
ARGUMENT
As stated by Respondents, the legal issue involved in this
case is whether a newspaper’s truthful publication, in violation
of a criminal statute, of the name of a juvenile who is suspected
in the homicide of a local high school student and who is the
subject of juvenile court proceedings is protected speech under
the First Amendment of the United States Constitution. This
case does not involve the allegation that the Respondent
newspapers unlawfully obtained the identity of the juvenile
suspect. Nor does this case involve the scope of a state’s power
to deny access to juvenile court proceedings’ or to punish
participants in said proceedings for violating a mandate of
confidentiality.
As stated by this Court in Mills v. Alabama, 384 U.S. 214,
218-19 (1966),
Whatever differences may exist about interpretations
of the First Amendment, there is practically universal
agreement that a major purpose of the Amendment
was to protect the free discussion of governmental
affairs.
See also Cox Broadcasting Corp. v. Cohn, 420 U.S. 469, 491-92,
94 (1975); Garrison v. Louisiana, 379 U.S. 64, 74 (1964); New
‘Your amicus agrees that in the presence of a compelling
interest, it may be permissible for the state to attempt to preserve the
confidentiality of certain information by limiting the access of the
press to the sources of such information. Pell v. Procunier, 417 U.S.
817, 834 (1974). Furthermore, this Court has held that the press
enjoys no greater right of access than that of the general populace.
Houchins v. KQED, Inc., US. , 57 L.Ed 2d 553 (1978).
ANPA strongly asserts, however, that it is unconstitutional to prohibit
publication of information, no matter how such information is obtain-
ed. Nebraska Ass'n v. Stuart, 427 U.S. 539, 570 (1976) ( Brennan, J.,
concurring). It is similarly unconstitutional to punish, by criminal
sanction, the publication of “information once it falls into the hands of
the press, unless the need for secrecy is manifestly overwhelming.”
Landmark Communications Inc., v. Virginia, US. , 56
L.Ed. 2d 1, 17 (1978).
7
York Times Co. v. Sullivan, 376 U.S. 254, 270 (1964). Your
amicus respectfully submits that, as a general matter, the
operations of the local juvenile court system in its effort to cope
with the increasing problems of youth crime and juvenile
delinquency are “governmental affairs” of public interest to
citizens within the affected community. More specifically, the
apprehension, incarceration, judicial disposition, and identity of
a local juvenile alleged to have fatally and feloniously shot a
classmate while attending a local public high school are un-
doubtedly matters which legitimately concern students and
adults alike and constitute protected speech under the First
Amendment.
Counterposed against the constitutional right to publish the
identity of a suspected murderer is the juvenile suspect’s so-
called “right to rehabilitation,” asserted herein by the state
acting in its parens patriae role.2 Petitioners contend that a vital
aspect of the process of rehabilitating juvenile offenders is
maintaining to the greatest extent possible the confidentiality of
the juvenile’s name. It is contended that focusing public
attention on a juvenile miscreant hampers that juvenile’s efforts
to reintegrate himself into lawful society and to lead a normal
life. Petitioners maintain that, rather than serving as a deterrent
to further delinquent behavior, publication of the names of
juveniles involved in delinquency proceedings handicaps the
2 In 1899 the Chicago Bar Association described the function of a
state juvenile court system acting in its parens patriae role:
The fundamental idea of the juvenile court law is that the
state must step in and exercise guardianship over a child
found under such adverse social or individual conditions as
to develop crime .... It proposes a plan whereby he may
be treated not as criminal or legally charged with crime,
but as a ward of the state, to receive practically the care,
trust and discipline that are accorded the neglected and
dependent child, and which, as the State acts, shall
approximate as nearly as may be that which should be
given by parents. R. Pound, “The Juveniie Court and the
Law,” National Probation Association Yearbook, 1944,
Vol. 1, No. 3, p. 13.
8
juveniles’ ability to obtain employment and earn the respect
and confidence of the local community. Thus, Petitioners
contend that, by barring publication, the state’s efforts at
successful rehabilitation of its wayward juveniles are enhanced
to a degree sufficient to outweigh the abridgement of First
Amendment freedoms imposed by West Virginia Code 49-7-3.
Petitioners urge this Court to endorse the decision in
Government of Virgin Islands v. Brodhurst, 285 F.Supp. 831
(D.C. Virgin Islands, 1968). There, the United States District
Court for the Virgin Islands held “that the advantages accom-
plished by the shielding of the names of juveniles from
publicity outweighed those gained by allowing the publication
of the names of children, [and that] [t]he limitation placed
upon the press was justified in light of the interest of rehabilitat-
ing juvenile offenders.” Brief of the Petitioners at 9. While
recognizing the vital need for providing a juvenile court system
which can offer effective means of rehabilitating youthfv!
offenders, your amicus respectfully submits that the statutory
“right” of juvenile suspects in West Virginia not to have their
identities disclosed by newspapers is of no constitutional con-
sequence. It simply is not sufficiently compelling to justify the
creation of a new exception to the constitutional prohibition on
prior restraints on publication.
I. Under The Decisional Authority Governing Application
Of The First Amendment To The United States Con-
stitution, West Virginia Code 49-7-3 Constitutes An
Impermissible Prior Restraint On Constitutionally Pro-
tected Speech
In Nebraska Press Ass’n v. Stuart, Mr. Justice Brennan
correctly noted:
{I]t has been generally, if not universally, considered
that it is the chief purpose of the [First Amend-
ment’s] guaranty to prevent previous restraints upon
publication. Near v. Minnesota ex rel. Olson, 283 U.S.
697, 713 [1930]
9
427 U.S. 539, 588 (1976) (Brennan, J., joined by Stewart and
Marshall, J.J., concurring). Thus, “[a]ny system of prior
restraints of expression comes to this Court bearing a heavy
presumption against its constitutional validity.” Bantam Books,
Inc. v. Sullivan, 372 U.S. 58, 70 (1963).
It also is true, however, that “the [First Amendment]
protection even as to previous restraint is not absolutely unlim-
ited.” Near v. Minnesota, 283 U.S. 697, 716 (1930). The
established exceptions to such protection against previous re-
straints upon publication fall into three categories:
The first two exceptions were that “the primary
requirements of decency may be enforced against
obscene publications,” and that “[t]he security of the
community life may be protected against incitements
to acts of violence and the overthrow by force of
orderly government [for] [t]he constitutional guar-
anty of free speech does not ‘protect a man from an
injunction against uttering words that may have all
the effect of force....’”
Nebraska Press Ass’n, supra, at 590 (Brennan, J. concurring,
citing Near v. Minnesota, supra).
The third recognized exception, but one which this Court
has never actually applied in practice, may arise when our
country is at war, during which time “[n]o one would question
but that a government might prevent actual obstruction to its
recruiting service or the publication of the sailing dates of
transports or the number and location of troops.” Near v.
Minnesota, supra at 716.
Yet, even in a situation of national emergency caused by
war, “the First Amendment [will] tolerate absolutely no prior
3 These exceptions now have come to be construed as situations
involving communications other than “speech” as encompassed with-
in the meaning of the First Amendment. See, e.g., Miller v.
California, 413 U.S. 15 (1973); Roth v. United States, 354 U.S. 476,
481 (1957); Chaplinsky v. New Hampshire, 315 U.S. 568 (1942).
10
judicial restraints of the press predicated upon surmise or
conjecture that untoward consequences may result.” New York
Times Co. v. United States, 403 U.S. 713, 725-26 (1971)
(Brennan J., concurring). Previous restraint upon the freedom
of speech encompassed within the First Amendment is per-
missible only when said speech “wiil surely result in direct,
immediate, and irreparable damage to our Nation or its
people.” Jd. at 730 (Stewart, J., joined by White, J., con-
curring). Cf., Craig v. Harney, 331 U.S. 367, 373 (1947);
Schenck v. United States, 249 U.S. 47, 52 (1919).
It is clear that West Virginia Code 49-7-3 imposes a prior
restraint on speech which is protected under both the First
Amendment to the United States Constitution and Article 3, §7
of the Constitution of West Virginia.‘ It requires newspapers
(and only newspapers) to obtain a court order before publish-
ing the name of a juvenile who is the subject of a delinquency
proceeding. It also is clear that the alleged violation of a
juvenile offender’s right to rehabilitation, which Petitioners
assert will result from publication of the juvenile offender’s
identity, does not fall within the traditional exceptions to the
ban on prior restraints. The issue which this Court must face,
therefore, is whether a juvenile offender’s specific right under
West Virginia Code 49-7-3 not to have his identity published
constitutes either (a) a new right of constitutional dimension
which justifies the curtailment of freedom of speech or (b) a
compelling state interest which is seriously and imminently
threatened by the publication at issue herein and which cannot
be accomplished by other means less restrictive of First Amend-
ment freedoms. See, e.g., McLaughlin v. Florida, 379 U.S. 184,
196 (1964); Bates v. Little Rock, 361 U.S. 516, 524 (1960);
Craig v. Harney, 331 U.S. 367, 373 (1947).
4 No law abridging the freedom of speech, or of the press, shall
be passed; but the legislature may by suitable penalties, restrain the
publication or sale of obscene books, papers, or pictures, and provide
for the punishment of libel, and defamation of character, and for the
recovery, in civil actions, by the aggrieved party, of suitable damages
for such libel, or defamation.
it can be assumed that significant state interests underlie
West Virginia’s statutory policy of providing a mechanism for
the rehabilitation, rather than punishment, of its juvenile
offenders. In other jurisdictions the courts have held that
juvenile inmates have a constitutional right to rehabilitative
treatment. See Nelson v. Heyne, 491 F.2d 352 (7th Cir. 1974);
Morales v. Thurman, 383 F.Supp. 53 (E.D. Tex. 1974);
Martarella v. Kelley, 349 F.Supp. 575 (S.D.N.Y. 1972); In-
mates of Boys Training School v. Affieck, 346 F.Supp. 1354
(D.R.I. 1972). These courts have held that the minimal
treatment required to provide incarcerated juveniles their right
to constitutional due process “should, so far as can be reason-
ably required, be what proper parental care would provide.”
Nelson v. Heyne, 491 F.2d 352, 360 (7th Cir. 1974). None of
these decisions, however, have held that provision for maintain-
ing the confidentiality of a juvenile offender’s identity is either
an element of due process or necessary to prevent cruel and
unusual punishment.
Nor has this Court definitively decided that a youth
confined under jurisdiction of a juvenile court has a general
constitutional right to treatmentS or that a provision such as
West Virginia Code 49-7-3 is a necessary element in either a
constitutional or a compelling state statutory scheme of
rehabilitation.6
5 The primary thrust of this court’s decisions in Jn re Winship,
397 U.S. 358 (1970) and In re Gault, 387 U.S. | (1967) is the
desirability, or rather necessity, for accurate fact-finding and adjudica-
tive procedures. Cf., McKeiver v. Pennsylvania, 403 U.S. 528, 531
(1971) (juveniles not entitled to jury trial).
6 The fundamental constitutional interest in protecting the press
from previous restraints on publication need not be balanced herein
against the state’s interest in the rehabilitation of maladjusted or
delinquent juveniles. I: is not contended herein that the numerous
elements of West Virginia’s juvenile rehabilitation program other than
West Virginia Code 49-7-3 conflict with Respondents’ First Amend-
ment freedoms. Nor have Petitioners demonstrated that an effective
overall program of rehabilitation necessitates keeping the identity of
juvenile offenders confidential.
12
As justification for the prior restraint on publication im-
posed by the statute in question, Petitioners also advert to the
West Virginia state policy of rehabilitation as discussed in State
ex rel. Harris vy. Calendine, 233 S.E. 2d 318 (W.Va. 1977).
There, the West Virginia Supreme Court of Appeals reaffirmed
that a juvenile defendant in a delinquency proceeding is
entitled to the procedural protections of the due process clause
of the Fourteenth Amendment to the Federal Constitution.
See, In re Gault, 387 U.S. 1, 24 (1967); State ex rel. Wilson v.
Barnbrick, 195 S.E. 2d 7Z1 (W.Va. 1973); W.Va.Code, 49-5-10
(1975). While noting that “[t]he legislature could choose to
punish children guilty of criminal conduct ..., but as a matter
of public policy ... provided instead for a comprehensive sys-
tem of child welfare,”” 233 S.E.2d at 325, the Court specifically
held that because of the fundamental difference between a
juvenile status offender and a juvenile criminal offender, the
indiscriminate incarceration of status offenders together with
criminal offenders violated the status offenders’ right to equal
protection of the laws, their right to substantive due process,
and their right to protection against cruel and unusual punish-
ment. Thus, Petitioners’ reliance upon Harris is misplaced, for
the Court there did not address either the specific state policy
contained in West Virginia Code 49-7-3 or the resolution of any
7 The court nevertheless acknowledged that “[i]t has always
been assumed that the Legislature can at any time withdraw some or
all of the benefits of this system from children guilty of criminal
conduct.” 233 S.E.2nd at 326. Thus, although legal proceedings for
the adjudication of a juvenile as a “delinquent” must comport with
procedural due process, and the incarceration of status offenders
under the states’ statutory policy of parens patriae must afford
substantive due process and equal protection of the laws, the court did
not hold that either the general right of a juvenile criminal offender to
rehabilitation, or his specific right not to have his identity published, is
a constitutional protection.
13
conflict between a juvenile criminal offender’s right to have his
identity kept secret and the First Amendment rights of anyone
else.®
In assessing whether West Virginia’s policy for the
rehabilitation of Stewart Perrock, as advanced by section
49-7-3, outweighs the First Amendment right of newspapers to
publish his identity, various factors relevant to this Court’s
standard of review must be borne in mind. First, this Court has
made it clear that laws which regulate activities protected by
the First Amendment are not accorded the presumption of
constitutionality normally accorded to acts of a legislature. See
United States v. C.1.0., 335 U.S. 106( 1948). Second, statutes
regulating constitutionally protected activities must be more
than merely rational; the government must have a compelling
state interest to justify the curtailment of otherwise protected
speech, and the scope of the curtailment must not be greater
than reasonably necessary to serve the state’s purpose. Thomas
v. Collins, 323 U.S. 516, 530 (1945).
Il. Where A Statutory Scheme Requiring Official Per-
mission To Exercise First Amendment Rights Is Uncon-
stitutional For Lack Of Standards, Such Statutory
Scheme May Be Ignored With Impunity
Your amicus respectfully submits that the Supreme Court
of Appeals of West Virginia correctly concluded that West
8In Landmark Communications, Inc. v. Virginia, US.
_____, 56 L.Ed.2d 1, (1978), the Commonwealth of Virginia argued
that criminal penalties against third parties who divulge information
regarding confidential proceedings before a state judicial review
commission were necessary to insure the effectiveness of said commis-
sion, and thereby protect the reputation of its judges and maintain the
integrity of its judicial system. Yet this Court held that “neither the
Commonwealth’s interest in protecting the reputation of its judges,
nor in maintaining the institutional integrity of its courts is sufficient to
justify the subsequent punishment of speech at issue here, even on the
assumption that criminal sanctions do in fact enhance the guarantee of
confidentiality.” Jd. at 12.
id
Virginia Code 49-7-3 imposed a prior restraint upon publica-
tion. The language of the statute prohibits publication without
explicit court permission:
Nor shall the name of any child in connection with any
proceedings under this chapter be published in any
newspaper without a written order of the court.
Review and analysis of the cases decided by this Court and
of the theory underlying the doctrine of prior restraint demon-
Strate that the statute at issue, both on its face and in effect,
operates as an unlawful prior restraint on publication.® More-
over, it is firmly established that, where a statute imposes a
prior restraint without adequate standards, a person faced with
such an unconstitutional statute may ignore it and engage with
impunity in the exercise of the right of free expression for which
9In Professor Thomas I. Emerson’s now famous article, “The
Doctrine of Prior Restraint,” 20, Law and Contemp. Prob. 648,
(1955), he sets out four categories, the first of which is pertinent to
analysis of the case at bar. Professor Emerson states:
The clearest form of prior restraint arises in those
situations where the government limitation, expressed in
Statute, regulation, or otherwise, undertakes to prevent
future publication or other communication without ad-
vance approval of an executive official. Such limitations
are normally enforced by criminal prosecution for having
published without the required approval, the prosecution
being based upon mere failure to obtain approval and not
on any issue concerning the content or manner of the
publication. Examples of this type of prior restraint are the
English licensing laws, motion picture censorship, the
requirement of permits for park meetings, and the like. In
some cases, the method of enforcement may be refusal by
the official to make available government facilities or
services, such as in denial of the use of the mails.
Id. at 655.
The statutory scheme in question involves a slight variation. A
judicial official rather than an executive official is empowered to grant
or refuse approval to publish. But here again, prosecution is based
upon “mere failure to obtain approval” and not upon the content or
manner of publication.
15
the law purports to require prior official approval. Shut-
tlesworth v. City of Birmingham, 394 U.S. 147 (1969). “[This]}
rule seems eminently sound and has not been seriously con-
tested.” T. EMERSON, THE SYSTEM OF FREEDOM OF EXPRESSION,
378-79 (1970). See also, Kunz v. New York, 340 U.S. 290, 293-
94 (1951); Schneider v. State, 308 U.S. 147, 161-62 (1939);
Lovell v. Griffin, 303 U.S. 444 (1938).
In Shuttlesworth v. City of Birmingham, 394 U.S. 147
(1969), this Court held violative of the First Amendment a
statute giving a City Commission power to refuse to issue a
permit for any “parade,” “procession” or “demonstration”
where the Commission determined that the “public welfare,
peace, safety, health, decency, good order, morale or con-
venience” were endangered. This result was reached in spite of
the Supreme Court of Alabama’s attempt to “perform ...
plastic surgery upon the face of the ordinance” by holding that,
in the future, certain standards should apply. Jd. at 153-54.
Writing for the Court, Justice Stewart, made an unequivo-
cal finding that a prior restraint existed and that the statute
could be properly ignored by those who sought to exercise First
Amendment rights. The opinion stated:
[A] law subjecting the exercise of First Amend-
ment freedoms to the prior restraint of a license,
without narrow, objective and definite standards to
guide the licensing authority is unconstitutional. “It
is settled by a long line of recent decisions of this
Court that an ordinance, which:like this one, makes
the peaceful enjoyment of freedoms which the Con-
stitution guarantees contingent upon the uncontrolled
will of an official—as by requiring a permit or license
which may be granted or withheld in the discretion of
such official—is an unconstitutional censorship or
prior restraint upon the enjoyment of those free-
doms.” Staub v. Baxley, 355 U.S. 313, 322.
16
394 US. at 150-51. Justice Stewart went on to say:
And our decisions have made clear that a person
faced with such an unconstitutional licensing law may
ignore and engage with impunity in the exercise of
the right of free expression for which the law purports
to require a license.
Id.
This Court reached a similar conclusion in Hague v. C.1.0.,
307 U.S. 496 (1938). There, a city ordinance purportedly
forbade public assembly in parks or streets in the absence of an
appropriate permit; such a permit could be obtained only from
a local official who was empowered to refuse issuance of the
permit if, in his judgment, riots or disturbances would be
prevented thereby. The ordinance was struck down as violative
of the First Amendment.
In Cantwell v. Connecticut, 310 U.S. 296 (1940), a Con-
necticut statute, which required religious groups to obtain
approval from a state administrative office prior to soliciting
support for their organizations, was held to constitute an
unlawful prior restraint on the exercise of First Amendment
rights. Speaking for a unanimous Court, Justice Roberts stated:
But to condition the solicitation of aid for the perpet-
uation of religious views or systems upon a license,
the grant of which rests in the exercise of a determi-
nation by state authority as to what is a religious
cause, is to lay a forbidden burden upon the exercise
of liberty protected by the Constitution.
310 US. at 307.
More recently, in Southeastern Promotions, Ltd. vy. Conrad,
420 U.S. 546 (1975), this Court struck down as violative of the
First Amendment a statutory scheme which enabled a munici-
pal licensing board to deny permission to use a city-leased
theater where, in the Board’s view, the production sought to be
17
presented would not be “in the best interests of the commu-
nity.” This standard was held to be lacking in constitutionally
required procedural safeguards. Justice White and Chief
Justice Burger pointed out in dissent, however, that the stan-
dard lease form used by the city required compliance with state
and local laws governing obscenity and “in this respect the
licensing system [was] not without standards.” Jd. at 564. In
the area of obscenity. however, this Court has developed a well
established body of constitutional law providing extensive
jurisprudential standards for determining when a prior restraint
on publication is constitutionally permissible under state law.
Reference to that body of law provides state and local adminis-
trative authorities and courts with the ultimate standards under
which they may exercise their authority to grant or deny use of
the theater.
In the case before this Court, there is no analogous body of
law to provide a judge in a juvenile proceeding with standards
for determining when the name of the accused may be pub-
lished. Moreover, it seems clear from Shuttlesworth that a
statute which provides no standards on its face may not be
rendered constitutional by “plastic surgery”, however skillfully
performed, by an appellate court. 394 US. at 153-54.
West Virginia Code 49-7-3 requires that a newspaper
obtain a “permit” in the form of a court order prior to
publishing the name of a juvenile adjudicated delinquent. This
statute is without any standards whatever. It therefore allows a
judge to act in an arbitrary manner with unfettered discretion in
regard to the issuance of orders allowing publication.
The fact that a judicial official rather than an adminis-
trative official is the grantor of the “license” provides no basis
for distinguishing this statute from the statute held uncon-
stitutional in Shuttlesworth. The fear that an administrative
official, exercising his discretion in the absence of appropriate
standards, may make decisions based on his own pre-
dispositions and beliefs is applicable equally to judges. As
18
Justice Douglas stated in Chandler v. Judicial Council, 398 US.
74 (1970):
Judges are not fungible; they cover the con-
stitutional spectrum; and a particular judge’s empha-
sis may make a world of difference when it comes to
rulings on evidence, the temper of the courtroom, the
tolerance for the proffered defense, and the like.
Lawyers recognize this when they talk about ‘shop-
ping’ for a judge; Senators recognize this when they
are asked to give their “advice and consent” to
judicial appointments; laymen recognize this when
they appraise the quality and image of the judiciary
in their own community.
Id. at 137 (Douglas, J., dissenting), quoted with approval in
Laird v. Tatum, 409 U.S. 824, 834 (1972) (Rehnquist, J.,
mem.). For this reason, judges as well as administrators must
be supplied with narrow, objective and definite standards when
First Amendment rights are involved.
To distinguish West Virginia Code 49-7-3 on the ground
that it involves a judicial rather than an administrative official
would be to exalt form over substance. As this Court has
recognized, “[g]overnmental restraint on publishing need not
fall into familiar or traditional patterns to be subject to
constitutional limitations on governmental powers.” Miami
Herald Publishing Co. v. Tornillo, 418 U.S. 241, 256 (1974).
In view of the foregoing, it is clear that West Virginia Code
49-7-3 imposes an unconstitutional prior restraint on publica-
tion by requiring a newspaper to obtain a court order before it
may publish, while providing no standards to govern the
issuance of such an order. When controls on publication
operate in advance through a system of administrative permits,
court injunction, or, as here, judicial sanction, delay is endemic.
Time is of the essence in “the reporting of news by the media,
[for] each passing day may constitute a separate and cogni-
zable infringement of the First Amendment. The suppressed
19
information grows older. Other events crowd upon it. To this
extent, any First Amendment infringement that occurs with
each pa‘sing day is irreparable.” Nebraska Press Ass’n. v.
Stuart, 423 U.S. 1327, 1329 (1975) (Blackmum, Circuit Jus-
tice, mem). A prior restraint is more easily imposed, requires
less foundation in provable facts, and is less carefully weighed
than is the imposition of subsequent punishment. Even the best
intended system of advance controls is difficult to administer in
a way that fully safeguards First Amendment rights; an ill-
intended system easily can be utilized to throttle those rights.
“If the constitutional protection of a free press means anything,
it means that government cannot take it upon itself to decide
what a newspaper may and may not publish.” Landmark
Communications, Inc., v. Virginia, USS. , 56 L.ed 2d 1,
17 (1978) (Stewart, J., concurring ).
Il. West Virginia Code 49-7-3 Is Constitutionally
Deficient In Failing To Require, Prior To Its Appli-
cation, A Showing Of Its Probable Effectiveness In
Achieving The State Interest It Is Designed To Serve.
In assessing whether a particular state interest is sufficient
to justify the curtailment of free speech, this Court has taken the
firm position that, where a prior restraint on publication is
involved, the probable efficacy of such a measure must be
carefully assessed. In Nebraska Press Ass’n v. Stuart, 427 US.
539 (1976), this Court struck down a gag order prohibiting
publication on the ground, inter alia, that the practical prob-
lems involved placed the efficacy of the order in grave doubt.
Chief Justice Burger, writing for the Court, stated:
Finally, we note that the events disclosed by the
record took place in a community of 850 people. It is
reasonable to assume that, without any news ac-
counts being printed or broadcast, rumors would
travel swiftly by word of mouth. One can only
speculate on the accuracy of such reports, given the
generative propensities of rumors; they could well be
20
more damaging than reasonably accurate news ac-
counts. But plainly a whole community cannot be
restrained from discussing 2. subject intimately affect-
ing life within it.
Id. at 567.
Your amicus respectfully submits that a statute prohibiting
publication by newspapers of the name of a juvenile offender is
similarly ineffective and therefore unconstitutional. Under the
terms of West Virginia Code 49-7-3, news media other than
newspapers are free to publish the names of juvenile offenders;
and ail news media evidently may publish other details about a
juvenile offender which in a community the size of St. Albans,
West Virginia, may be just as identifying as his name—i.e., his
address, his parents’ names, his school, his photograph, etc. In
addition, court reporters, prosecuting attorneys, defense at-
torneys, and other participants in delinquency proceedings are
not subject to this statute and presumably may divulge a
juvenile offender’s identity with impunity.
The ineffectiveness of this statute in the instant case can be
easily demonstrated. The alleged murder occurred in the town
of St. Albans, West Virginia, a community of approximately
14,300 people.'? Many of the residents of this community were
personally acquainted with both the accused and the victim.
There were seven eyewitnesses to the shooting. News sources
for a story published by the Charleston Daily Mail on February
10, 1978, included a Lieutenant in the Kanawha County
Sheriff's Office, a trooper with the West Virginia State Police,
and an Assistant Prosecuting Attorney for Kanawha County.
Moreover, the name of the accused had already been made
public by the broadcast media on February 9, 1978, prior to
publication by the Charleston Gazette and Daily Mail. In light
of these facts, there can be little doubt that the prohibition upon
publication contained in West Virginia Code 49-7-3 is in-
effective in preserving the anonymity of juvenile offenders.
10 Rand McNally Commercial Atlas & Marketing Guide (1977)
(estimated population ).
21
Your amicus respectfully submits that, at the time and
under the circumstances of Respondents’ publications, there
was absolutely no evidence that, but for such publications
Stewart Perrock’s identity would have remained confidential, or
that his chances for ultimate rehabilitation would have been
diminished in any way. Moreover, the statute in question is
constitutionally deficient in failing to require this type of an
assessment of the effectiveness of the restraint on publication.
IV. West Virginia Code 49-7-3 Violates The Equal
Protection Clause Of The Fourteenth Amendment In
Requiring That Only Newspapers Obtain A Court
Order Prior To Publication.
The Supreme Court of Appeals of West Virginia found it
unnecessary to address the equal protection issue, choosing
instead to decide this case on First Amendment grounds. The
question of equal protection, however, was argued before that
court. In a recent case characterized by a similar procedural
posture, this Court utilized as the basis for its decision an
argument which was raised but not addressed by the court
below. Regents of the University of California v. Bakke,
U.S. , 57 L.Ed.2d 750, 765 (1978).
Your amicus respectfully submits that the West Virginia
statute which prohibits all newspapers from publishing the
name of juveniles accused of a crime, while permitting the
accused’s name to be broadcast or disseminated by other
individuals, clearly violates the equal protection guarantees
embodied in the Fourteenth Amendment. The right to equal
protection assures that the government cannot “legislate that
different treatment be accorded to persons placed by a statute
into different classes on the basis of criteria wholly unrelated to
the objective of that statute. A classification ‘must be reason-
able, not arbitrary, and must rest upon some ground of
difference having a fair and substantial relation to the object of
the legislation, so that all persons similarly circumstanced shall
be treated alike.’ Royster Guano Co. v. Virginia, 253 U.S. 412,
22
415 (1920).” Reed v. Reed, 404 U.S. 71, 75-76 (1971). A
denial of equal protection is subject to “strict scrutiny” where
the classification involved affects “basic civil rights.” Skinner v.
Oklahoma ex rel. Williamson, 316 U.S. 535, 541 (1942).
Among those rights is the right to publish a newspaper. Gitlow
v. New York, 268 U.S. 652 (1925). This Court has required
strict scrutiny whenever a classification is even “closely inter-
twined” with First Amendment rights. Chicago Police Depart-
ment v. Mosley 408 U.S. 92, 95 (1972). See also NAACP v.
Button, 371 U.S. 415, 438 (1963); Mancuso y. Taft, 476 F.2d
187, 192-96 (Ist Cir. 1973). Under this standard, “the crucial
question is whether there is an appropriate governmental
interest suitably furthered by the differential treatment.” Chi-
cago Police Department v. Mosley, supra at 95. The statute in
question clearly fails this test. The state of West Virginia is
apparently attempting to prevent the dissemination of the
names of juveniles accused of crimes. This objective is in no
way “furthered” by prohibiting publication in a newspaper
while allowing the name to be disseminated by the broadcast
media.
In two cases involving broadcasting regulations, this Court
has upheld differential treatment for broadcasters as opposed to
newspapers. See CBS v. Democratic National Committee, 412
U.S. 94 (1973); Red Lion Broadcasting Co., Inc. v. FCC, 395
U.S. 367 (1969). In Red Lion, this Court concluded that such
differential treatment was warranted because:
[ B]roadcast frequencies constituted a scarce resource
whose use could be regulated and rationalized only
by the Government. Without government control,
the medium would be of little use because of the
cacaphony of competing voices, none of which could
be clearly and predictably heard.
Id. at 376.
Your amicus strongly asserts that Red Lion and CBS are
inapposite to the case before this Court. In those cases, federal
23
regulation of the broadcast media was held permissible on the
ground that inherent differences in the technical nature of the
broadcast media justified differential treatment under the First
Amendment. In the case before this Court, the discriminatory
treatment which newspapers receive is arbitrary, irrational, and
unrelated to the purposes the statute seeks to achieve. Broad-
casting a juvenile’s name may well result in greater dis-
semination than “illegal” publication in a newspaper. The
differential treatment afforded newspapers by this statute,
therefore, is certainly not based on inherent differences in the
nature of the two media. Differential treatment among various
media of expression is only permissible if “reasonable and
applied without discrimination.” Red Lion, supra at 387; Ko-
vacs v. Cooper, 336 U.S. 77 (1949). The differential treatment
directed at newspapers by West Virginia Code 47-7-3 is
manifestly unreasonable and discriminatory since no legitimate
state purpose is served in prohibiting only one medium from
disseminating the name of a juvenile, particularly where the
broadcast media may well reach a larger audience.
Your amicus does not suggest, that redrafting the statute to
include the broadcast media would render it constitutionally
permissible. The statute would still violate the First Amend-
ment. We note in passing that all our arguments regarding
prior restraints on publication should apply with equal weight
to prior restraints on broadcasting. See Miami Herald Publish-
ing Co. v. Tornillo, 418 U.S. 241 (1974).
y
:
24
CONCLUSION
In light of the foregoing, your amicus urges this Court to
uphold the ruling of the Supreme Court of Anpeals of West
Virginia in striking down West Virginia Code, Section 49-7-3 as
an unconstitutional prior restraint on the right of a newspaper
to publish. Likewise, this Court well might find the West
Virginia Statute to be violative of the equal protection clause of
the Fourteenth Amendment, in denying to newspapers a right,
enjoyed by other media, to fully inform the public.
Respectfully submitted,
ARTHUR B. HANSON
FRANK M. NORTHAM
MITCHELL W. DALE
ARTHUR D. McKEy
HANSON, O’BRIEN, BIRNEY
AND BUTLER
888 Seventeenth Street, N.W.
Suite 1000
Washington, D.C. 20006
Attorneys for Amicus Curiae
Amican Newspaper Publishers
Association
This is a copy of a public record, reproduced as it was published. It is not legal advice, and it may not be the version a court would rely on. Check the official source before you cite it.